Protein Info for PFLU_RS26350 in Pseudomonas fluorescens SBW25-INTG

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 7 to 159 (153 residues), 95.7 bits, see alignment E=1.2e-31 PF04542: Sigma70_r2" amino acids 9 to 76 (68 residues), 45.3 bits, see alignment E=1.2e-15 PF07638: Sigma70_ECF" amino acids 32 to 163 (132 residues), 34.8 bits, see alignment E=3.2e-12 PF08281: Sigma70_r4_2" amino acids 106 to 157 (52 residues), 57.9 bits, see alignment E=1.3e-19 PF04545: Sigma70_r4" amino acids 112 to 157 (46 residues), 38.4 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to pfs:PFLU5363)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2G5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PFLU_RS26350 RNA polymerase sigma factor (Pseudomonas fluorescens SBW25-INTG)
MSDVDLKGLFLKHADTLRGYLARKVRDPQLAADLVQESFLRLAEKPAGERIDNSQGYLYR
TASNLLIDHIRQEARRKTDSVPHEALAEIEDDVAGLEAQAMAQQQRQALKQALAELPERT
QQIFRLNRIEGMTHAQVARHLDISDSSVQKHLAKALAYVMQRLQEGEVAPSDE