Protein Info for PFLU_RS26220 in Pseudomonas fluorescens SBW25-INTG

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 245 (234 residues), 126.4 bits, see alignment E=7.7e-41

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to pfs:PFLU5335)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2D8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PFLU_RS26220 sulfite exporter TauE/SafE family protein (Pseudomonas fluorescens SBW25-INTG)
MVEHEWLTGAGLVLLGVITGFIGTNTGGSVFLTVPVMIWLGIPPQSSIATARLASVGTMF
AGLRHFHNSGKVDYRLAAPAAALGLAGALIGASLLVQIDPALLHKIIGGLTLLLVALSLI
RKPHSPKATPSSLRRFCGYVLFVPVGMIGGLFGGQAKLSTYLYIIFFKKTISESMGTRKV
GGLILSVGSLIIFGISGIINWQYGCCLIIGTLVGANAGAKFALQKGDKWMESAFNVVVVA
LALKMLFW