Protein Info for PFLU_RS26065 in Pseudomonas fluorescens SBW25-INTG

Annotation: chromosome partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF02195: ParBc" amino acids 22 to 110 (89 residues), 41.7 bits, see alignment E=1e-14 PF07506: RepB" amino acids 112 to 277 (166 residues), 63.1 bits, see alignment E=3.8e-21

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 100% identity to pfs:PFLU5304)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2A7 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PFLU_RS26065 chromosome partitioning protein ParB (Pseudomonas fluorescens SBW25-INTG)
MNMPHHPRSPLHVGEATTILMVSLDRIRVLNPRARNKQVFAKLVENISNLGLKRPITVTP
SSDQDNSDFFELVCGQGRYEAYCALGEREIPCVVVSASEADRFLISLVENLARRKHTNKD
LLYSIQILSDRGYTTKQISMKTSLDPTYINAILLLLRQGEERLISAVEKGWLPITLATMV
ARSSDTEVQVAMVEAYETGLLKGEQLIKVRRLIDRRRFSGKNYGQKRSATEQSTTPQKLL
STYQTEVRRQRVMLKKADINEQRVLIIVTAMRRLLADDYFCTLLRSENIADMPKSLADRI
QGEA