Protein Info for PFLU_RS25735 in Pseudomonas fluorescens SBW25-INTG

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00072: Response_reg" amino acids 4 to 109 (106 residues), 81.6 bits, see alignment E=1.4e-26 PF00158: Sigma54_activat" amino acids 147 to 313 (167 residues), 248.8 bits, see alignment E=6.9e-78 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 88.8 bits, see alignment E=1.2e-28 PF07728: AAA_5" amino acids 170 to 291 (122 residues), 36 bits, see alignment E=2e-12 PF00004: AAA" amino acids 171 to 291 (121 residues), 21.3 bits, see alignment E=9.2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5237)

Predicted SEED Role

"Two-component sensor CbrB: intrcellular carbon:nitrogen balance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K244 at UniProt or InterPro

Protein Sequence (476 amino acids)

>PFLU_RS25735 sigma-54-dependent Fis family transcriptional regulator (Pseudomonas fluorescens SBW25-INTG)
MPHILIVEDETIIRSALRRLLERNQYQVSEAGSVQEAQERFSIPTFDLIVSDLRLPGAPG
TELIKLGQGTPVLIMTSYASLRSAVDSMKMGAVDYIAKPFDHDEMLQAVARILRDRQSAS
SAPVEQRPAGKAADKPGVDNSNGEIGIIGSCPPMQDLYSKIRKVAPTDSNVLIQGESGTG
KELVARALHNLSKRAKAPMISVNCAAIPESLIESELFGHEKGAFTGASAGRAGLVEAADG
GTLFLDEIGELPLEAQARLLRVLQEGEIRRVGSVQSQKVDVRLIAATHRDLKSLAKIGQF
REDLYYRLHVIALKLPALRERGADVNEIASAFLLRQSARINRTDLKFAPDAEQAIRHYSW
PGNVRELENAVERAVILSESPEISAELLGIDIELSDLEEDDFIGLAPQHGGGSNTSHEPT
EDLSLEDYFQHFVLEHQDHMTETELARKLGVSRKCLWERRQRLGIPRRKTGVASES