Protein Info for PFLU_RS25715 in Pseudomonas fluorescens SBW25-INTG
Annotation: RNA polymerase-binding protein DksA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to DKSA_SALTI: RNA polymerase-binding transcription factor DksA (dksA) from Salmonella typhi
KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to pfs:PFLU5233)Predicted SEED Role
"C4-type zinc finger protein, DksA/TraR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K240 at UniProt or InterPro
Protein Sequence (146 amino acids)
>PFLU_RS25715 RNA polymerase-binding protein DksA (Pseudomonas fluorescens SBW25-INTG) MSTQAKQQQQSLSGFTPYVEAKGEEYMGKPMRQHFTNILKKWKQDLMQEVDRTVDHMKDE AANFPDPADRASQEEEFALELRARDRERKLIKKIDKTLQLIEDEEYGWCESCGVEIGIRR LEARPTADLCVDCKTLAEIKEKQVGK