Protein Info for PFLU_RS24325 in Pseudomonas fluorescens SBW25-INTG

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00749: glucokinase
  • amino acids 5 to 310 (306 residues), 262.1 bits, E=3.5e-82
• PF02685: Glucokinase
  • amino acids 5 to 315 (311 residues), 356.4 bits, E=6.5e-111

Best Hits

Swiss-Prot: 55% identical to GLK_PSEA8: Glucokinase (glk) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to pfs:PFLU4963)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (12/15 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• trehalose degradation I (low osmolarity) (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• homolactic fermentation (9/12 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation II (cytosolic) (1/2 steps found)
• trehalose degradation IV (1/3 steps found)
• chitin biosynthesis (5/9 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

See C3K176 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PFLU_RS24325 glucokinase (Pseudomonas fluorescens SBW25-INTG)
MKLALVGDIGGTNARFALWRDQELHSIRVHATADHTSPEEAIKVYLNEEGLEIGDIGAVC
LSVAGPVSGDEFKFTNNHWRLSKTAFCKTLQVDELLLVNDFSAMALGMTRLKPDEFRVVC
AGTPEPLRPAVVIGPGTGLGVGTLLDLGAGRFAALPGEGGHVDLPLSSPRETQLWQHIYS
EIGHVSAETALSGGGLPRLYRAICAVDGHTPVLETPEAITAAGLAGDPVAMEVLDQFSIW
LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFIRSGFAKSFSDKGCMSDYFKGIPVWLVT
APYSGLTGAGVALEQAFA