Protein Info for PFLU_RS24135 in Pseudomonas fluorescens SBW25-INTG

Annotation: HIT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF01230: HIT" amino acids 8 to 98 (91 residues), 63.9 bits, see alignment E=9.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4924)

Predicted SEED Role

"Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYT8 at UniProt or InterPro

Protein Sequence (141 amino acids)

>PFLU_RS24135 HIT domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MFALDQRLQQDTLVMGDFPLCRLLLSNDSNYPWFILVPRINAISEVFQLDVADQQRLWQE
TTALAQSLNGGFCADKMNIGALGNVVSQLHVHVIVRKRDDAAWPAPVWGKHPAQPYTDAQ
VAAIRGRLRELLPADFIFTQG