Protein Info for PFLU_RS24080 in Pseudomonas fluorescens SBW25-INTG

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 10 to 135 (126 residues), 159.5 bits, see alignment E=4.7e-51 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 13 to 130 (118 residues), 113.9 bits, see alignment E=5.3e-37 PF13279: 4HBT_2" amino acids 19 to 137 (119 residues), 59.9 bits, see alignment E=3.3e-20 PF03061: 4HBT" amino acids 24 to 107 (84 residues), 58.9 bits, see alignment E=5.2e-20

Best Hits

Swiss-Prot: 49% identical to YBGC_ECOL6: Acyl-CoA thioester hydrolase YbgC (ybgC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 100% identity to pfs:PFLU4912)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYS6 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PFLU_RS24080 tol-pal system-associated acyl-CoA thioesterase (Pseudomonas fluorescens SBW25-INTG)
MRAQNGDQSFAHRCRVYYEDTDAGGIVYYVNYLKFMERARTERLRELGFAQSQLAGEDLL
FVVHSSEARYHAPARLDDELLVSAEVIELNRVSLRFKQQVRRATDATLLCEGQFLVACVR
TNSLKPRAIPEALRAAFADVSGAGKQSKQEI