Protein Info for PFLU_RS23935 in Pseudomonas fluorescens SBW25-INTG

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF06490: FleQ" amino acids 4 to 85 (82 residues), 22.3 bits, see alignment E=2.1e-08 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 96.8 bits, see alignment E=1.4e-31 PF00486: Trans_reg_C" amino acids 148 to 222 (75 residues), 57.4 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 48% identical to CPXR_ECO57: Transcriptional regulatory protein CpxR (cpxR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4884)

MetaCyc: 48% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYP8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PFLU_RS23935 response regulator transcription factor (Pseudomonas fluorescens SBW25-INTG)
MSELLLIDDDQELCELLTSWLSQEGFQVRACHDGLSARKALADSAPAAVVLDVMLPDGSG
LELLKQLRNDHPELPVLMLSARGEPLDRILGLELGADDYLAKPCDPRELTARLRAVLRRS
HPAAVSTQLELGDLCFSPVRGVVSIDEQEFALTVSESRLLEALLRQPGEPLDKQELAQIA
LGRKLTLYDRSLDMHVSNLRKKIGPHPDGRPRIVALRSRGYYYSL