Protein Info for PFLU_RS23765 in Pseudomonas fluorescens SBW25-INTG

Annotation: AGE family epimerase/isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 120 to 133 (14 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF07221: GlcNAc_2-epim" amino acids 40 to 394 (355 residues), 414.1 bits, see alignment E=2.6e-128

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4847)

Predicted SEED Role

"N-acylglucosamine 2-epimerase (EC 5.1.3.8)" in subsystem Sialic Acid Metabolism (EC 5.1.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZ78 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PFLU_RS23765 AGE family epimerase/isomerase (Pseudomonas fluorescens SBW25-INTG)
MTTQPLPVSSWLNAAAHHAWLAAEGQRLLAFAKASRLPDGFGNLNDRGQLPADARAETMN
TARMTHSFAMAHAMGLPGYAELVEHGVTCLNGPLRDAEHGGWFAAPHALDGNRGKAAYLH
AFVALAASSAVVAGAPGARTLLNDAIPIIDQFFWSEEEGVMLESFAQDWSGVEAYRGANS
NMHATEAFLALADVTGDTRWLDRALRIVERVIHTHAAGNQFMVIEHFDVHWQPLLGYNED
NPADGFRPYGITPGHGFEWARLVLHLEAARLQAGLVTPEWLVTDAKGLFASACEYAWAVD
GAPGIVYTLDWNHRPVVRERLHWTHAEASAAAQALLKRTGELHYETWYRRFWEFCEAHFI
DRLHGSWHHELSPHNQPSSNIWGGKPDLYHAWQAVVLPALPLAPSMASAIGAGLYVTSW