Protein Info for PFLU_RS23745 in Pseudomonas fluorescens SBW25-INTG

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00005: ABC_tran" amino acids 21 to 163 (143 residues), 120 bits, see alignment E=3e-38 PF17912: OB_MalK" amino acids 237 to 291 (55 residues), 45.7 bits, see alignment 2.5e-15 PF08402: TOBE_2" amino acids 284 to 357 (74 residues), 42.9 bits, see alignment E=1.1e-14 PF03459: TOBE" amino acids 303 to 356 (54 residues), 37.3 bits, see alignment 6.4e-13

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to pfs:PFLU4843)

Predicted SEED Role

"Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)" (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZ74 at UniProt or InterPro

Protein Sequence (386 amino acids)

>PFLU_RS23745 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Pseudomonas fluorescens SBW25-INTG)
MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG
AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRQNIEFGLKIRKMAQADIDAEVARVA
KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL
MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNDPANLFVASFIGSPP
MNFVPMRLKRKEGRLVALLDSGQARCELPLGMNDAGLEDRDVILGLRPEQIVLAAGEGNG
SSSIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPAKVLLFDAN
TGERLGTASSLPAQGHADNVAQFKGR