Protein Info for PFLU_RS23725 in Pseudomonas fluorescens SBW25-INTG

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 8 to 484 (477 residues), 585.8 bits, see alignment E=3.4e-180 PF00479: G6PD_N" amino acids 13 to 183 (171 residues), 174.9 bits, see alignment E=2.8e-55 PF02781: G6PD_C" amino acids 186 to 484 (299 residues), 406.3 bits, see alignment E=6.6e-126

Best Hits

Swiss-Prot: 76% identical to G6PD_PSEAE: Glucose-6-phosphate 1-dehydrogenase (zwf) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to pfs:PFLU4838)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.49

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZ70 at UniProt or InterPro

Protein Sequence (488 amino acids)

>PFLU_RS23725 glucose-6-phosphate dehydrogenase (Pseudomonas fluorescens SBW25-INTG)
MPSITVEPCTFALFGALGDLALRKLFPALYQLDGAGLLHDDTRILALAREAGSEQQHLAH
IEQALRKYVGKELDETIAQRFLARLTYVHVDFMKADDYVALAEIAGTAQRLIAYFATPAA
VYGAICENLSKVGLAENTRVVLEKPIGSDLESSRKVNDAVAQFFPENRTYRIDHYLGKET
VQNLIALRFANSLFETQWNQNYISHVEITVAEQVGIEGRWGYFDKAGQLRDMIQNHLLQL
LCLIAMDPPADLSADSIRDEKVKVLKALAPISPDGLTTQVVRGQYIAGYSAGKPVPGYLE
EENSNTQSDTETFVALRADIRNWRWAGVPFYLRTGKRMPQKLSQIVIHFKEPSHYIFAPE
QRLQISNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTYRSARIPDAYER
LLLEVMRGNQNLFVRKDEIEAAWKWCDQLIAGWKKSGDAPKPYAAGSWGPMSSIALITRD
GRSWYGDI