Protein Info for PFLU_RS23620 in Pseudomonas fluorescens SBW25-INTG

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 37 to 468 (432 residues), 127.8 bits, see alignment E=5.8e-41 PF07690: MFS_1" amino acids 69 to 328 (260 residues), 70 bits, see alignment E=1.9e-23 amino acids 324 to 460 (137 residues), 42.9 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to pfs:PFLU4817)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZ51 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PFLU_RS23620 MFS transporter (Pseudomonas fluorescens SBW25-INTG)
MPTLSSTDGIDPLRAAHISARIDRLPAVATVWRLVALLSIGGFFELYDLFQTAYISPGLI
SDGIFHTGSEGVFGFSDQAAFASATFLGLFLGASLLSPIADRFGRRAIFTFALIWYTVAT
VLMGIQTSALGIICMRFLVGIGLGIELVTIDAYLSELVPKRMRSSAFAFAFFIQFLSVPA
VALMSWWLVPQAPFGISGWRWVVLSSAVFALFIWQLRKRLPESPRWLAQKGRFDEAGKIM
DNLEARCRKDHGKPLDEPEPQAVSVHGSGRFADIWQPPYRRRALMLIVFHVFQAIGFFGF
GNWLPALLSGQGVSVTHSLLYAFIITLAYPLGPLLFVKVANRFENKWQIVGSALGAVIFG
SLFALQTTAVGLVICGVMITFCNAWLSFSYHSYQSELFPTNIRARAVGFCYSFSRLSTVF
SSLLIGFILEHLGTPGVLAFIASSMLIVMITISWFGPRTRNLALENIAH