Protein Info for PFLU_RS23370 in Pseudomonas fluorescens SBW25-INTG

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 PF13175: AAA_15" amino acids 12 to 360 (349 residues), 73.1 bits, see alignment E=5.4e-24 PF13304: AAA_21" amino acids 29 to 360 (332 residues), 55.3 bits, see alignment E=1.6e-18 PF20469: OLD-like_TOPRIM" amino acids 435 to 480 (46 residues), 25.3 bits, see alignment 2.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4769)

Predicted SEED Role

"FIG00846885: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JY01 at UniProt or InterPro

Protein Sequence (647 amino acids)

>PFLU_RS23370 AAA family ATPase (Pseudomonas fluorescens SBW25-INTG)
MILVAGLFLRHYGVYKNINYIPLSDGENFTSLIGENGVGKSSILDALDKYFNHKDSKDWV
INKQAQLEGGISTNDKTPFISPLFLISISDSNKHLDENSIKSLEAISNYLWSSSKKGVLD
DFLTHRDTIKTTEAETTHYLISIGKRHNEKDAFFLTFEPELKKIFDDLSLDFKLETTKLL
AWIIESITYLYIPVETNVNSFTKLEAADMQILMDKNIHREVGSSIDERTVKEINKNLDNF
ITDIEKNLPDYKYKSTGKRKNLTKLDIVQKTIEAYFSVKILHRKVGTSEVPIQHLSSGEK
RRALVDLAYAYLVHGDVREKDVILAIDEPESSLHVSACFNQFENLKKIAQNKTQLIITTH
WYGHLPILSSGKSVLISKEGNEIQKDSFNLSNYREQIAQEQKALKQNAPPYSVQLKSYND
LTQSIIESLQNGYNWIICEGSSEKIYFEHFFKEEIEKQRLCILPCGGSAEVLRMARYIKT
PLQDKNIAITGKVLCLIDTDIEAKTFEHDNNLSNLLVKRLLNINSTIELVEINDIRKIPA
TEIEDALDPRIYFETLSSFDNPEINRILETSDFDHAAVNSADCMDLKTSEKVIIKDFFDG
PNIKYNFAKKYVEFSDLDPIGFFPSWVGKIKEEFIEIKPKLIRRRKP