Protein Info for PFLU_RS23175 in Pseudomonas fluorescens SBW25-INTG

Annotation: flagellar basal body rod protein FlgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR01395: flagellar basal-body rod protein FlgC" amino acids 5 to 147 (143 residues), 167 bits, see alignment E=1.4e-53 PF00460: Flg_bb_rod" amino acids 7 to 34 (28 residues), 33.4 bits, see alignment 3.6e-12 PF06429: Flg_bbr_C" amino acids 95 to 145 (51 residues), 58.2 bits, see alignment E=7e-20

Best Hits

KEGG orthology group: K02388, flagellar basal-body rod protein FlgC (inferred from 100% identity to pfs:PFLU4730)

Predicted SEED Role

"Flagellar basal-body rod protein FlgC" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0Q9 at UniProt or InterPro

Protein Sequence (147 amino acids)

>PFLU_RS23175 flagellar basal body rod protein FlgC (Pseudomonas fluorescens SBW25-INTG)
MSLSSVFNIAGSGMSAQTTRLNTVASNIANAETVSSSIDQTYRARHPVFATMFQGGQSGG
SDSLFQDQGAAGSGVQVLGVVEDQSNLEARYEPNHPAANEKGYVYYPNVNVVEEMADMIS
ASRSFQTNAEMMNTAKTMMQKVLTLGQ