Protein Info for PFLU_RS22735 in Pseudomonas fluorescens SBW25-INTG

Annotation: bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02137: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
  • amino acids 1 to 202 (202 residues), 382.5 bits, E=2e-119
• PF00702: Hydrolase
  • amino acids 47 to 164 (118 residues), 40.5 bits, E=4e-14
• PF12710: HAD
  • amino acids 60 to 160 (101 residues), 33.4 bits, E=6.1e-12

Best Hits

Swiss-Prot: 93% identical to THRH_PSESM: Phosphoserine phosphatase (PSPTO_2281) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02203, phosphoserine / homoserine phosphotransferase [EC: 2.7.1.39 3.1.3.3] (inferred from 100% identity to pfs:PFLU4641)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39, 3.1.3.3

Use Curated BLAST to search for 2.7.1.39 or 3.1.3.3

Sequence Analysis Tools

See C3K020 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PFLU_RS22735 bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH (Pseudomonas fluorescens SBW25-INTG)
MEIACLDLEGVLVPEIWIAFAEKTGIESLRATTRDIPDYDVLMKQRLRILDEHGLKLADI
QEVIATLKPLDGAIEFVNWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHRLITDEND
RVVSYQLRQKDPKRQSVLAFKTLYYRVIAAGDSYNDTTMLGEADRGILFHAPENVIREFP
QFPAVHTFEALKKEFIKASNRPLSL