Protein Info for PFLU_RS22370 in Pseudomonas fluorescens SBW25-INTG

Annotation: cadmium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 814 transmembrane" amino acids 179 to 197 (19 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 451 to 476 (26 residues), see Phobius details amino acids 751 to 768 (18 residues), see Phobius details amino acids 774 to 794 (21 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 5 to 87 (83 residues), 96.5 bits, see alignment E=3.8e-31 PF00403: HMA" amino acids 94 to 154 (61 residues), 31.9 bits, see alignment 4.2e-11 TIGR01511: copper-translocating P-type ATPase" amino acids 229 to 794 (566 residues), 463.4 bits, see alignment E=2.4e-142 TIGR01525: heavy metal translocating P-type ATPase" amino acids 246 to 794 (549 residues), 508 bits, see alignment E=8.1e-156 TIGR01512: cadmium-translocating P-type ATPase" amino acids 273 to 795 (523 residues), 367.9 bits, see alignment E=1.6e-113 TIGR01494: HAD ATPase, P-type, family IC" amino acids 282 to 527 (246 residues), 115.2 bits, see alignment E=5.6e-37 amino acids 607 to 772 (166 residues), 108.6 bits, see alignment E=5.5e-35 PF00122: E1-E2_ATPase" amino acids 308 to 485 (178 residues), 165.9 bits, see alignment E=2.1e-52 PF00702: Hydrolase" amino acids 502 to 706 (205 residues), 99.3 bits, see alignment E=1.1e-31 PF12710: HAD" amino acids 623 to 702 (80 residues), 29.3 bits, see alignment E=3.5e-10 PF08282: Hydrolase_3" amino acids 678 to 737 (60 residues), 39.2 bits, see alignment 2.1e-13

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 100% identity to pfs:PFLU4565)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0S5 at UniProt or InterPro

Protein Sequence (814 amino acids)

>PFLU_RS22370 cadmium-translocating P-type ATPase (Pseudomonas fluorescens SBW25-INTG)
MTTPCYHCALPVPSGSRFTSVILGARRELCCPGCQAVAEAIVAGGLESYYQHRSEASANP
ETLPVQLLDELALYDRADVQKPFVRHEGDLAEATLLMEGISCAACGWLIEKHLRSLPAVA
EARLNLSNHRLQVRWADGQLPLSQLLSELRHIGYAAHPYQADRAAEQLAGENRLALRQLG
VAGLLWFQAMMATMATWPEFNIDLSPELYVILRWVAMFLTTPIVFYSCAPFFKGAMRDLR
TRHLTMDVSVSLAIGGAYLAGIWTAITGVGELYFDAVGMFALFLLAGRYLERRARERTAA
ATAQLVNLLPASCLRLKADGQSERILLPELALGDRVLVHPGAVLPADGVILDGHSSIDES
LLTGEYLPQPRQTGDAVTAGTLNVEGALTVEVRALGHDTRLSAIVRLLERAQAEKPRLAQ
IADRAAQWFLLCSLIAAALIGLLWWELDASRAFWIVLAMLVATCPCALSLATPTALTAAT
GTLHKLGLLLTRGHVLEGLNQIDTVIFDKTGTLTEGRLALRAIRPLGSLSTDLCLSLAAA
LENRSEHPIARAFGRAPLAADEVLSSPGLGLEGRVGERLLRIGQPGFVCELSGCAIPAAP
ELSGQWLLLGDREGALAWFVLDDRLRSDAPALLAACKARGWRTLLLSGDSSPMVASVAAE
LGIDEAHGGLRPDDKLRVLQHLHKEGRKVLMLGDGVNDVPVLAAADISVAMGTATDLAKT
SADAVLLSNRLDALVHAFTLARRTRRVIIENLLWAGLYNGLMLPFAALGWITPIWAAIGM
SLSSLTVVLNALRLTRLPSAPAARAPSVTRPLPV