Protein Info for PFLU_RS22360 in Pseudomonas fluorescens SBW25-INTG

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 43 to 472 (430 residues), 582.9 bits, see alignment E=2.1e-179 PF13746: Fer4_18" amino acids 221 to 326 (106 residues), 151.5 bits, see alignment E=3.1e-48 PF11614: FixG_C" amino acids 357 to 472 (116 residues), 102.7 bits, see alignment E=4.6e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4563)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K015 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PFLU_RS22360 cytochrome c oxidase accessory protein CcoG (Pseudomonas fluorescens SBW25-INTG)
MSNQIPVHDVTPPAKHTNGSDSKTVDLYASREKIYTRAFTGLFRNLRMLGGAGLFLLYFG
TVWLNWGGHQAVWWNLPERKFFIFGATFWPQDFILLSGILIVAAFGLFFITVYAGRVWCG
YTCPQSVWTWIFMWCEKVTEGDRNQRIKLDKAPMGANKFLRKFSKHTLWLLIGFVTGMTF
VGYFSPIRELVFEFFTGQADGWSYFWVGFFTLATYGNAGWLREQVCIYMCPYARFQSVMF
DKDTLIVSYDPRRGEVRGPRKKGIDYKAQGLGDCIDCTMCVQVCPTGIDIRDGLQIECIG
CAACIDACDNIMDKMDYPRGLISYTTEHNLSGQKTHKLRPRLIGYALVLLAMMGLLAAAF
FMRSLVGFDVSKDRVLYRENAEGRIENVYSLKIMNKDQRDHTYVLDAAGLPDLKLQGRRE
IKVAAGDIVSMPVELSSAPEQLPSSTNEVTFILTDADDASVHIEAKSRFIGPQVR