Protein Info for PFLU_RS22200 in Pseudomonas fluorescens SBW25-INTG

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 126 (29 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 186 (17 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 188 to 256 (69 residues), 56.6 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4527)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JY76 at UniProt or InterPro

Protein Sequence (432 amino acids)

>PFLU_RS22200 mechanosensitive ion channel family protein (Pseudomonas fluorescens SBW25-INTG)
MDIKQLWLNVQDLWGALDEHPLLHASLGFVVLLVVALLLGRVARYLILHAVKLLGRQPAL
HWLNDLRHNKVFHRLAQMTPSLVIQFGLYLVPDLSKTAILFIGNVALALTILFLVLAMSA
LLSALLDIYARTEHARTRSIKGYVQLAKMVLFVFGAIIIVATLIDRSPLLLLSGLGAMSA
VILLVYKDTLLSFVASVQLTSNDMLRVGDWIEMPQVGADGDVVDITLHTVKVQNFDKTIV
SIPTWRLMSESFKNWRGMQASGGRRIKRSLFIDASGVRFLRDDEELRMTQVHLLTDYIGR
KQAELKAWNEAQGHSAQLSANRRRMTNLGTFRAYALAYLKSHPDIQPNMTCMVRQMQTTA
QGVPLEIYCFTRTTAWADYERIQGDIFDYLLAVLPEFGLSLYQQPSGNDLRAGVLPAVLG
ASHLPPPESRAG