Protein Info for PFLU_RS22005 in Pseudomonas fluorescens SBW25-INTG

Annotation: cobyric acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF13500: AAA_26" amino acids 3 to 230 (228 residues), 62 bits, see alignment E=1e-20 TIGR00313: cobyric acid synthase CobQ" amino acids 4 to 476 (473 residues), 484.4 bits, see alignment E=1.9e-149 PF01656: CbiA" amino acids 4 to 230 (227 residues), 77.5 bits, see alignment E=1.3e-25 PF07685: GATase_3" amino acids 250 to 433 (184 residues), 195 bits, see alignment E=1.6e-61

Best Hits

Swiss-Prot: 100% identical to COBQ_PSEFS: Cobyric acid synthase (cobQ) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to pfs:PFLU4486)

MetaCyc: 49% identical to CobQ (Pseudomonas denitrificans (nom. rej.))
Adenosylcobyric acid synthase (glutamine-hydrolyzing). [EC: 6.3.5.10]

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0Z0 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PFLU_RS22005 cobyric acid synthase (Pseudomonas fluorescens SBW25-INTG)
MSTLMVQGTTSDAGKSTLVTALCRWLIRQGVAVAPFKPQNMALNSAVTAEGGEIGRAQAV
QAQAANLAPHTDMNPVLLKPNSDTGSQVIIHGRAVTSMNAVAYHDYKAIAMQAVLASHAR
LSEAYPVVMVEGAGSPAEINLRANDIANMGFAEAVDCPVLLIADINRGGVFAHLVGTLEL
LSPTEQARVKGFIINRFRGDIALLQPGLDWLEARTGKPVVGVLPYVMDLHLEAEDGIDRR
QIDKAAQVLKVVVPVLPRISNHTDFDPLRLHPQVDLQFVGPGQPIPAADLIILPGSKSVR
SDLAYLRANGWETAVARHLRYGGKVLGICGGLQMLGEQVHDPLGLEGPAGSSDGLGLLAF
STTLEEEKQLRNVRGRLLLEDAQVSGYEIHAGVTTGDGLSNAAVLLDDGRSDGAQSADGQ
ILGTYLHGLFETAAACSALLRWAGLEDVQAVDYHALRERDIERLADLVENHLDTELLREL
CGI