Protein Info for PFLU_RS21790 in Pseudomonas fluorescens SBW25-INTG

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF13188: PAS_8" amino acids 79 to 135 (57 residues), 42.1 bits, see alignment 1.4e-14 PF00989: PAS" amino acids 80 to 118 (39 residues), 30.9 bits, see alignment 5.8e-11 PF00512: HisKA" amino acids 186 to 249 (64 residues), 42.8 bits, see alignment E=1.1e-14 PF02518: HATPase_c" amino acids 295 to 395 (101 residues), 77.9 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: K10942, two-component system, sensor histidine kinase FlrB [EC: 2.7.13.3] (inferred from 100% identity to pfs:PFLU4442)

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0U8 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PFLU_RS21790 PAS domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MPHAAQLSTAPAIQGLVPPVEPPTRQGLEQAFSQFNQMSSQLTDSYSLLEARVSELKGEL
AVVSAQRMEELAEKERLANRLQNLLSLLPGGVIVIDEEGRVREANPAACDMLGLPLEGEL
WRHVITRCFAPREDDGHEISLKDGRRLSIATRSLDAEPGQLVLLNDLTETRHLQDQLARH
ERLSSLGRMVASLAHQIRTPLSAALIYASHLTDEQLPVATHQRFAGRLKERLHELEHQVR
DMLVFARGELPLTDRITPAELMQALQAAAATHIQDVHVRWQCDSHLGELLCNRDTLVGSL
LNLIENATQASGPDARLKVHLYNREQNLRLCISDSGSGIEPAVLQRLGEPFFTTKTNGTG
LGLTVVKAVARAHQGELQLHSRVGRGTCALMTLPLFSCAASAE