Protein Info for PFLU_RS21710 in Pseudomonas fluorescens SBW25-INTG

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 75 (34 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details PF00813: FliP" amino acids 48 to 240 (193 residues), 278.4 bits, see alignment E=1.7e-87 TIGR01103: flagellar biosynthetic protein FliP" amino acids 48 to 244 (197 residues), 291.2 bits, see alignment E=2e-91

Best Hits

Swiss-Prot: 82% identical to FLIP_PSEAE: Flagellar biosynthetic protein FliP (fliP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to pfs:PFLU4425)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0I8 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PFLU_RS21710 flagellar type III secretion system pore protein FliP (Pseudomonas fluorescens SBW25-INTG)
MRVLLTLMLLLATPLAFGADPLSIPAITLGTNAAGAQEYSVSLQILLIMTALSFIPAFVM
LMTSFTRIIIVFSILRQALGLQQTPSNQILTGMALFLTLFIMAPVFDKVNQQALQPYLAE
KMTAQDAIDKAQGPIKDFMLSQTRSSDLELFMRLSKRTDIATPDQAPLTILVPAFVTSEL
KTAFQIGFMIFIPFLIIDLVVASVLMAMGMMMLSPLIISLPFKIMLFVLVDGWALIIGTL
ASSFGGV