Protein Info for PFLU_RS21135 in Pseudomonas fluorescens SBW25-INTG

Annotation: TenA family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF03070: TENA_THI-4" amino acids 34 to 154 (121 residues), 40.1 bits, see alignment E=3.7e-14 PF14518: Haem_oxygenas_2" amino acids 55 to 231 (177 residues), 42 bits, see alignment E=9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4307)

Predicted SEED Role

"Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K055 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PFLU_RS21135 TenA family transcriptional regulator (Pseudomonas fluorescens SBW25-INTG)
MIDTFNRTGPLMEASSYPAWAQKLILDCSESKRRVVEHELYQRMRDNTLSAKTMRHYLIG
GWPVVEQFALYMAQNLTKTKFARHPGEDMARRWLMRNIRVELNHADYWVHWARAHGVSLE
ELQAQNVPPELHALSHWCWHTSSADSLIVAIAATNYAIEGATGEWSAVVCSTGVYAAAFP
EEERKRAMKWLKMHAQYDDAHPWEALEIICTLAGMNPTKELQAELRQAVCKSYDYMFLFL
ESCMRLEKEKAPAVMRERQARVASEA