Protein Info for PFLU_RS20800 in Pseudomonas fluorescens SBW25-INTG

Annotation: HAD hydrolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 15 to 188 (174 residues), 82.2 bits, see alignment E=1e-26 PF12710: HAD" amino acids 17 to 187 (171 residues), 32.2 bits, see alignment E=2.3e-11 PF13419: HAD_2" amino acids 17 to 195 (179 residues), 120 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 38% identical to GPH_AGRFC: Phosphoglycolate phosphatase (gph) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to pfs:PFLU4235)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZX6 at UniProt or InterPro

Protein Sequence (227 amino acids)

>PFLU_RS20800 HAD hydrolase-like protein (Pseudomonas fluorescens SBW25-INTG)
MSINELKIAHPIQADAIIFDLDGTLVDSADDMTAQLNAILIERNLEPILVATTSLFLGDG
MRSFARRAFYLRGINNIEEAIDTFISRYEHTDHPMTKPYDGVIETLNALREAGWQISVCT
NKDESIAIDILKQTNLLKFMDVVCGGDTVSFMKPDPRHLGALVARADYGKLPKIMIGDNR
NDFEAARGYGIPFAFASWGYGSVPDDCKALNLKEFRDILDIVGLPGH