Protein Info for PFLU_RS20765 in Pseudomonas fluorescens SBW25-INTG

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 52% identical to Y1892_XYLFT: UPF0394 membrane protein PD_1892 (PD_1892) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 100% identity to pfs:PFLU4229)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZX1 at UniProt or InterPro

Protein Sequence (143 amino acids)

>PFLU_RS20765 hypothetical protein (Pseudomonas fluorescens SBW25-INTG)
MTLSPDFTPWTSLLGGALIGLSAGLFILLNGRIAGISGLLGSLLAKHGEGRAEKGLFLLG
LLASPWLWSLFGTLPSVSVQAGGAALVLAGLLVGIGTRYGAGCTSGHGICGLSRLSLRSL
VAVSCFMGSGFAAVYVTRHLIGA