Protein Info for PFLU_RS20515 in Pseudomonas fluorescens SBW25-INTG

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01134: amidophosphoribosyltransferase
  • amino acids 2 to 464 (463 residues), 536.4 bits, E=3.7e-165
• PF13522: GATase_6
  • amino acids 65 to 200 (136 residues), 55.6 bits, E=1.1e-18
• PF13230: GATase_4
  • amino acids 66 to 163 (98 residues), 25 bits, E=1.6e-09
• PF13537: GATase_7
  • amino acids 81 to 212 (132 residues), 43.2 bits, E=7e-15
• PF00156: Pribosyltran
  • amino acids 273 to 393 (121 residues), 34.8 bits, E=2.1e-12

Best Hits

Swiss-Prot: 91% identical to PUR1_PSEAE: Amidophosphoribosyltransferase (purF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to pfs:PFLU4183)

MetaCyc: 64% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

See C3JZS1 at UniProt or InterPro

Protein Sequence (501 amino acids)

>PFLU_RS20515 amidophosphoribosyltransferase (Pseudomonas fluorescens SBW25-INTG)
MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTSHDGRLFLRKDNGLVRDVFHQRHM
QRLVGHMGIGHVRYPTAGSSTSAEAQPFYVNSPYGITLAHNGNLTNVEQLAKEIYESDLR
HVNTSSDSEVLLNVFAHELAQRGKLQPTEEDVFAAVTDVHNRCVGGYAVVAMVTGYGIVG
FRDPHGIRPIVFGQRHTDEGVEYMIASESVSLDVLGFTLIRDLAPGEAVYITEDGKLHTR
QCAVAPKLTPCIFEHVYLARPDSIIDGVSVYKARLRMGEKLAEKILRERPEHDIDVVIPI
PDTSRTAALELANHLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQKLNAIELEFRGKN
VMLVDDSIVRGTTCKQIIQMAREAGAKNVYFCSAAPAVRYPNVYGIDMPSAHELIAHNRS
TQDVADLIGADWLIYQDLPDLIEAVGGGKIKIDQFDCAVFDGKYVTGDVDEAYLNKIEQA
RNDSSKIKTQAVSAIIDLYNN