Protein Info for PFLU_RS20450 in Pseudomonas fluorescens SBW25-INTG

Annotation: pyroglutamyl-peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00504: pyroglutamyl-peptidase I" amino acids 3 to 212 (210 residues), 332.2 bits, see alignment E=8.5e-104 PF01470: Peptidase_C15" amino acids 4 to 200 (197 residues), 249.2 bits, see alignment E=2e-78

Best Hits

Swiss-Prot: 100% identical to PCP_PSEFS: Pyrrolidone-carboxylate peptidase (pcp) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01304, pyroglutamyl-peptidase [EC: 3.4.19.3] (inferred from 100% identity to pfs:PFLU4174)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZR3 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PFLU_RS20450 pyroglutamyl-peptidase I (Pseudomonas fluorescens SBW25-INTG)
MRIVLLTGFEPFDQDPVNPSWEAVRQLEGVQLADDVQIIARRLPCAFATAGARLAQLIDE
LHPEMVIATGLGPGRSDISIERVAINVNDARIPDNLGEQPIDTAVAPDGPAAYFTTLPIK
AMVRAVRGAGIAASVSQTAGTFVCNQVFYLLQHALAATAVRSGFIHVPYLPEQVTGSQRP
SMALETMVAGLHAAVLAAWQTPVDAKEAGGQVS