Protein Info for PFLU_RS20015 in Pseudomonas fluorescens SBW25-INTG

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 100 to 130 (31 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 357 (3 residues), see Phobius details amino acids 367 to 396 (30 residues), see Phobius details amino acids 403 to 407 (5 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details amino acids 441 to 463 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to pfs:PFLU4095)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZG2 at UniProt or InterPro

Protein Sequence (466 amino acids)

>PFLU_RS20015 transporter (Pseudomonas fluorescens SBW25-INTG)
MALLIHLSPVLLVMSMLMVLRRPPVQAAIAGAALVAVLWLFEGLLPSAAMAAFKDTAVLF
ASTALVIVPGLAFVILIERMGVNQALSEWVQALGLKRAELVVFIVLGLAPLLEAMTGFGV
SLIATVPLLLSLFERRIALRVALTGMAIMPWGTLGLATVIGASLAHVDAAALASTSALTS
APVFIVLAALASYCCGVGISRALVGLGLLFLGVLYASSRWLGPEVAGVSAGLSVAATTLL
LALHRRQGATALAWPRKAWPYLALIICIVLLKGLNALTHLEDAWVVRGQHVAWKPLASPG
IALLLVLVWVHRRGGGALLGTLGARARRPLLTILFFLAMSQMMVKAGFLDGLVQVLIGLP
DSAAAPLVALLGGLSGYMTGSNVGGNAIFMPAVALLPESSRGLLAAVQNSAAGHAALGSL
SIVMLVLGLAKTSAEEEGQLVRFGFALACVNTALVALAGWVLLSVY