Protein Info for PFLU_RS19990 in Pseudomonas fluorescens SBW25-INTG

Annotation: iron-dicitrate ABC transporter permease FecC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF01032: FecCD" amino acids 18 to 327 (310 residues), 280.5 bits, see alignment E=1.5e-87 PF00950: ABC-3" amino acids 124 to 323 (200 residues), 21.2 bits, see alignment E=1.9e-08

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to pfs:PFLU4090)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecC (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZF8 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PFLU_RS19990 iron-dicitrate ABC transporter permease FecC (Pseudomonas fluorescens SBW25-INTG)
MQRSFAAMGILLLGAGVFWFSLYSWSPFTLTATDAWNGLVHQGSVGGNMAYIVAQLRVPR
AVCAALVGACLGLAGALMQGITRNRLASPSLFGVTAGAALGLALFSTGLVALPFAGGALL
MTCLGGALAWVTVFSLGGAWSPTTAQGRLVLAGVAVAALCAALTRLTVILVEAQAQSVLN
WLAGSLANVGAAQVQLLWPCTLIGGVWALWCAPRLNLINLGEDAARSLGVGIASLRLQVF
VASLLLVGASVCAVGPIGFVGLIAPNILRQFLGNDYRWLIPLSAAFGAVIVLGADLLSRA
VAFPVETPAGVVTALIGAPFFLFLARRAL