Protein Info for PFLU_RS19880 in Pseudomonas fluorescens SBW25-INTG

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 75 to 190 (116 residues), 53.1 bits, see alignment E=1.9e-18 PF00528: BPD_transp_1" amino acids 96 to 295 (200 residues), 69.5 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to pfs:PFLU4068)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZD6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PFLU_RS19880 amino acid ABC transporter permease (Pseudomonas fluorescens SBW25-INTG)
MPIVAKSYDLIDSPSPVRQARVSTPIKALQVVPARHPWRWAGSIFAALVLLAIVHSLATN
PRWEWGVFGQWFFSPSVLRGLGQTLLLTLLSTVFSIILGTALALARLSGSPLLAALAWGY
IWFFRSMPALLVLIILYNFAYLYDHIVLGVPFTGVVFAEWSTVDVLSQFTVAVLGLSLMQ
AAYAAEIIRGGLIGVDAGQHEAAAALGLPASRRIFRIILPQALRSILPSGFNEIIGLVKG
TSIVYVLALPELFYTVQVIYNRTQAVIPLLIVATVWYLIITTVLTSAQYYVERHFARGTA
RVLPPTPLQRLRGWLKEKTHG