Protein Info for PFLU_RS19865 in Pseudomonas fluorescens SBW25-INTG

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 51 to 83 (33 residues), 22 bits, see alignment (E = 2.2e-08)
• PF01266: DAO
  • amino acids 52 to 90 (39 residues), 33.6 bits, 8.1e-12
• PF00890: FAD_binding_2
  • amino acids 53 to 89 (37 residues), 25.1 bits, 2.4e-09
• PF13450: NAD_binding_8
  • amino acids 55 to 100 (46 residues), 42.9 bits, 1.2e-14
• PF01593: Amino_oxidase
  • amino acids 60 to 509 (450 residues), 124.4 bits, E=2.1e-39

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 100% identity to pfs:PFLU4065)

Predicted SEED Role

"Amine oxidase, flavin-containing"

MetaCyc Pathways

• phenylethylamine degradation I (2/2 steps found)
• putrescine degradation III (3/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (5/9 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• aromatic biogenic amine degradation (bacteria) (4/8 steps found)
• melatonin degradation II (1/4 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See C3JZD3 at UniProt or InterPro

Protein Sequence (527 amino acids)

>PFLU_RS19865 FAD-dependent oxidoreductase (Pseudomonas fluorescens SBW25-INTG)
MGLTRREALSSIAAVGGEQAAKDALAALGLGPSSHRRPQPLKLKSGLGQGTRVLVLGAGI
AGLVTALELTRAGFDVHVLEARERVGGRTWTIRNGDRVDYKDGRMQTAAFDPGHYFNAGP
ARIPSQHRTILDYCSELGVPLEVLVNSSHGAQVRPDVQKPAFTVGQAINDARGHVSGLLA
KAVQRDALDDLLSAEERTRLLAFLQVYGDLSQALAFDGTLRSGHLESPAHPGALPASRGP
LKLDQLLHPELWGALLHTEFPEFSATMFQPVGGMDRITDAFYQRVRGHVQLGAQVRRIRQ
LEDGVAVTYHDTLSGREQVVRADYLISTLPLPLLAKLDTDFSDPIKAALLSTRSDQATKV
AWQSPRFWETDYRTYGGLSWIEHPARLLWYPSNDLNTREGLLVAGYVTGEGADVFGAQPF
DKQYATSKEAVELLHPGYSKHLRHPLAVSWEQIPYSEGPWLQREHFPADASALLEAGHGR
VYFAGDGLVQSGVGIWQESAANSARHVVGQLAERVTQQTHLAALAAS