Protein Info for PFLU_RS19515 in Pseudomonas fluorescens SBW25-INTG

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00005: ABC_tran" amino acids 20 to 170 (151 residues), 106.6 bits, see alignment E=1.7e-34 amino acids 274 to 425 (152 residues), 67 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 64% identical to RBSA2_BURL3: Ribose import ATP-binding protein RbsA 2 (rbsA2) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to pfs:PFLU3995)

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYZ0 at UniProt or InterPro

Protein Sequence (502 amino acids)

>PFLU_RS19515 sugar ABC transporter ATP-binding protein (Pseudomonas fluorescens SBW25-INTG)
MSSLLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEGQ
ILIDGHAQHFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGLLRKRDMVE
ASEALFKRLGVTLDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAELL
FEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDRLVEMMVGR
RLECSFPPKPSSARGPLLLEVKDIQLVRNGPHNSFQLYKGEILGFAGLVGSGRTELALGM
MGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENISLNNLPK
YQNASGLIDKSRECASVESLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWINHHCDVLV
FDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEVIGMCDRVAVFHKGAIVKLLE
ASAVNPQEVMRHATGGSSEYVH