Protein Info for PFLU_RS19250 in Pseudomonas fluorescens SBW25-INTG

Annotation: dihydropyrimidinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR02033: dihydropyrimidinase" amino acids 3 to 455 (453 residues), 594.5 bits, see alignment E=7.7e-183 PF01979: Amidohydro_1" amino acids 50 to 437 (388 residues), 87.9 bits, see alignment E=8.3e-29 PF07969: Amidohydro_3" amino acids 357 to 434 (78 residues), 37.5 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 86% identical to HYDA_PSEAE: D-hydantoinase/dihydropyrimidinase (dht) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01464, dihydropyrimidinase [EC: 3.5.2.2] (inferred from 100% identity to pfs:PFLU3942)

MetaCyc: 48% identical to dihydropyrimidinase (Arabidopsis thaliana col)
Dihydropyrimidinase. [EC: 3.5.2.2]

Predicted SEED Role

"Dihydropyrimidinase (EC 3.5.2.2)" in subsystem Hydantoin metabolism or Pyrimidine utilization (EC 3.5.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYL3 at UniProt or InterPro

Protein Sequence (479 amino acids)

>PFLU_RS19250 dihydropyrimidinase (Pseudomonas fluorescens SBW25-INTG)
MSLLIRGATVITHDESYRADVLCAGGLIRAIGTNLNVPAGTEILDGSGQYLMPGGIDPHT
HMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPQQSLMDAFHQWRGWAEKSASDY
GFHVAITWWSEQVREEMAELVSHHGINSFKHFMAYKNAIMAADDTLVASFERCLELGAVP
TVHAENGELVYHLQRKLMAQGITGPEAHPLSRPSQVEGEAASRAIRIAETIGTPLYLVHV
STKEALDEITYARSKGQPVYGEVLAGHLLLDDSVYQHPDWQTAAGYVMSPPFRPRGHQEA
LWHGLQSGNLHTTATDHCCFCAEQKAAGRDDFSKIPNGTAGIEDRMALLWDEGVNTGRLS
MQEFVALTSTNTAKIFNLYPRKGAIRVGADADLVLWDPEGTRTISAKTHHQQVDFNIFEG
KTVRGVPSHTISQGKLVWADGDLRAERGAGRYVERPAYPAVFEQLSKRAAHSKPVAVNR