Protein Info for PFLU_RS19170 in Pseudomonas fluorescens SBW25-INTG

Annotation: ATP-dependent Clp endopeptidase proteolytic subunit ClpP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 19 to 208 (190 residues), 344.3 bits, see alignment E=9.6e-108 PF00574: CLP_protease" amino acids 29 to 208 (180 residues), 292 bits, see alignment E=9.2e-92

Best Hits

Swiss-Prot: 100% identical to CLPP_PSEFS: ATP-dependent Clp protease proteolytic subunit (clpP) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to pfs:PFLU3929)

MetaCyc: 72% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYK0 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PFLU_RS19170 ATP-dependent Clp endopeptidase proteolytic subunit ClpP (Pseudomonas fluorescens SBW25-INTG)
MFRNSYIQQNSDIQAAGGLVPMVVEQSARGERAYDIYSRLLKERVIFLVGPVEDYMANLI
CAQLLFLEAENPDKDIHLYINSPGGSVTAGMSIYDTMQFIKPNVSTTCIGQACSMGAFLL
TAGAEGKRFCLPNSRVMIHQPLGGFQGQASDIEIHAKEILFIRERLNTLMAKHSGHTLEE
IERDTNRDNFMSAEAARDYGLIDAVIDKRPA