Protein Info for PFLU_RS18740 in Pseudomonas fluorescens SBW25-INTG

Annotation: Dyp-type peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR01413: Dyp-type peroxidase family" amino acids 5 to 276 (272 residues), 166.9 bits, see alignment E=3.7e-53 PF20628: Dyp_perox_C" amino acids 127 to 275 (149 residues), 98.7 bits, see alignment E=1.7e-32

Best Hits

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 100% identity to pfs:PFLU3843)

Predicted SEED Role

"Predicted dye-decolorizing peroxidase (DyP), YfeX-like subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYA6 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PFLU_RS18740 Dyp-type peroxidase (Pseudomonas fluorescens SBW25-INTG)
MSQYQPGILAAPVPLQARHLFFAVDSLAAVPAALDALVQWADSAAVIGVGEPLVTALGAR
IEGLRAFPMVSGPGAHNPSTQQALWVWLHGVDRGELLLRSRTVEKALAPAFRLVQMIEGF
RYKTGFDLTDYEDGTENPHDDAAVEAALTDSGASFAALQQWQHDLDGFAALPAQERDHII
GRRHGDNEELEDAPESAHTKRTAQESFTPEAFVVRRSMPWAENGQAGLMFLAFGHSFDAF
EAQLRRMSGLEDGIVDGLYRISTPLTGGYYWCPPLKDGHLDLSAILPAANL