Protein Info for PFLU_RS18530 in Pseudomonas fluorescens SBW25-INTG

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 23 to 194 (172 residues), 137.4 bits, see alignment E=7.8e-44 PF17854: FtsK_alpha" amino acids 308 to 408 (101 residues), 112 bits, see alignment E=2.8e-36 PF01580: FtsK_SpoIIIE" amino acids 418 to 628 (211 residues), 247.1 bits, see alignment E=2.9e-77 PF09397: FtsK_gamma" amino acids 736 to 796 (61 residues), 87.8 bits, see alignment 6.3e-29

Best Hits

Swiss-Prot: 90% identical to FTSK_PSESM: DNA translocase FtsK (ftsK) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to pfs:PFLU3801)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JY58 at UniProt or InterPro

Protein Sequence (802 amino acids)

>PFLU_RS18530 DNA translocase FtsK (Pseudomonas fluorescens SBW25-INTG)
MKKSAATPKAAVVPAWRQHLHYRLKEGALIAIGALCLFLMMALLTYGKDDPGWSHNSKIE
DVQNFGGPAGSYSADILFMVLGYFAYIFPLLLAIKTWQIFRQRHEPWQWSGWLFSWRLIG
LVFLVLSGAALAHIHFHAPTGLPAGAGGALGESLGDLARKTLNIQGSTLMFIALFLFGLT
VFTDLSWFKVMDVTGKITLDLLELFQGAANRWWAARVERKRMVAQLREVDTRVNEVVAPS
TPDRREQAKVKERLIEREQALSKHMSDREKQVPPVIAPAPPKPAEPSHRVQKEKQAPLFV
DSAVEGTLPPISILDPAEKKQLNYSPESLAAVGHLLEIKLKEFGVEVSVDSIHPGPVITR
YEIQPAAGVKVSRISNLAKDLARSLAVTSVRVVEVIPGKTTVGIEIPNEDRQIVRFSEVL
STPEYDNFKSPVTLALGHDIGGKPVITDLAKMPHLLVAGTTGSGKSVGVNAMILSILFKS
GPDDAKLIMIDPKMLELSIYEGIPHLLCPVVTDMKDAANALRWSVAEMERRYKLMAKMGV
RNLSGFNAKVKEAQDAGTPLTDPLYKRESIHDEAPLLTKLPTIVVVVDEFADMMMIVGKK
VEELIARIAQKARAAGIHLILATQRPSVDVITGLIKANIPTRMAFQVSSKIDSRTIIDQG
GAEQLLGHGDMLYMPPGTSLPIRVHGAFVSDDEVHRVVEAWKLRGAPEYNDDILAGVEEA
GSGFDGGSSGGDDDAETDALYDEAVAFVLESRRASISAVQRKLKIGYNRAARMIEAMENA
GVVTAMNTNGSREVIAPGQMRD