Protein Info for PFLU_RS18200 in Pseudomonas fluorescens SBW25-INTG

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 149 to 172 (24 residues), see Phobius details TIGR00874: transaldolase" amino acids 4 to 305 (302 residues), 442.1 bits, see alignment E=6.4e-137 PF00923: TAL_FSA" amino acids 14 to 302 (289 residues), 300 bits, see alignment E=9.1e-94

Best Hits

Swiss-Prot: 81% identical to TAL_PSEPG: Transaldolase (tal) from Pseudomonas putida (strain GB-1)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to pfs:PFLU3732)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXV7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PFLU_RS18200 transaldolase (Pseudomonas fluorescens SBW25-INTG)
MTSKLEQLKQFTTVVCDTGDLEAISRLRPVDATTNPSLLLKAAAIPEYAELLRSAVSLSK
GDVDLACDRFAVSVGCGILKVIPGRISTEVDARLSFDEDALWAKANQLIALYDQAGVGRD
RVLIKLASTWEGIRTAERLEKAGIQTNLTLLFSFVQAAACADAGVFLISPFVGRIYDWYR
KNTGLDYTGAEDPGVQSVTRIYNYYKANAIKTVVMGASFRTLSQIEQLAGCDRLTISPEL
LQKLDEDQGLLERQLNPGAAGESRQTLTEAQFRWGSNEDAMATEKLAEGIRQFARDQEKL
EAVLAAL