Protein Info for PFLU_RS18165 in Pseudomonas fluorescens SBW25-INTG

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00456: Transketolase_N
  • amino acids 30 to 272 (243 residues), 132.7 bits, E=3.1e-42
• PF13292: DXP_synthase_N
  • amino acids 107 to 186 (80 residues), 24.3 bits, E=3.5e-09
• PF00676: E1_dh
  • amino acids 115 to 179 (65 residues), 23.6 bits, E=4.7e-09
• PF02775: TPP_enzyme_C
  • amino acids 119 to 186 (68 residues), 26.9 bits, E=7.6e-10

Best Hits

Swiss-Prot: 68% identical to APTA_ACTSZ: Apulose-4-phosphate transketolase subunit A (aptA) from Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to pfs:PFLU3725)

MetaCyc: 68% identical to apulose-4-phosphate transketolase subunit A (Actinobacillus succinogenes 130Z)
RXN-20930 [EC: 2.2.1.13]

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• D-apiose degradation I (2/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1 or 2.2.1.13

Sequence Analysis Tools

See C3JXV0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PFLU_RS18165 transketolase (Pseudomonas fluorescens SBW25-INTG)
MNAFQYDAHQIKEQARLIRRHVIRLNADSPAGGHTGADLSETDILATLYFRILNTGPERI
EDPERDIYIQSKGHGVGGLYCCLAQAGYIPVDWLPTYQHFNSHLPGHPVRQKTPGIELNT
GALGHGLPVAVGLALAAKMSGSKKRIYVLTGDGELAEGSNWEAAMAAAKYGLDNLFVIVD
KNKLQLAGLTAEIMPLDPLDVKWAAFGFRVSECDGNDVGQLIEALESMQAKTGVPQVLIA
HTIKGKGVSFIEARPEWHHRVPKGDEINAALEELSHGE