Protein Info for PFLU_RS18005 in Pseudomonas fluorescens SBW25-INTG

Annotation: acyl-CoA/acyl-ACP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 24 to 93 (70 residues), 31 bits, E=5.8e-11
• PF02770: Acyl-CoA_dh_M
  • amino acids 132 to 222 (91 residues), 51.1 bits, E=2.5e-17
• PF00441: Acyl-CoA_dh_1
  • amino acids 260 to 367 (108 residues), 36 bits, E=1.6e-12
• PF08028: Acyl-CoA_dh_2
  • amino acids 261 to 369 (109 residues), 39.9 bits, E=9.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3692)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

See C3JXS0 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PFLU_RS18005 acyl-CoA/acyl-ACP dehydrogenase (Pseudomonas fluorescens SBW25-INTG)
MTSSSQPSLRSVEVANFEALLERLSTELASTAHLYDESGAFPHANFTLLHEHGLVALTVP
KSLGGGGASLPQARKAISAIAKGEPSTALILVMQYLQHTRLQDSKTWPAHLRTQVANDAV
RDGALINALRVEPDLGTPARGGLPATTAVRTAEGWRISGRKIYSTGSHGLSWFSVWARSD
DADPLVGAWLVPKDSPGVSIIDTWDHLGMRATCSHEVVLDNVRVPLDHAVSVSPWSAPSP
ELDGEGFLWMSVLLSSVYDAVAQAARDWLVNWLEERQPSNLGAALSTLPRFQETVGHIDT
LLFANRSLLDAAAEGHTPSANAAQLKYLVTHNAIRAVELAIEASGNPGLSRHSPLQRHYR
DVLCSRVHTPQNDAVLQGVGKAVFAQRHKERP