Protein Info for PFLU_RS17145 in Pseudomonas fluorescens SBW25-INTG

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF02798: GST_N" amino acids 4 to 70 (67 residues), 49 bits, see alignment E=2.2e-16 PF00462: Glutaredoxin" amino acids 4 to 62 (59 residues), 36.7 bits, see alignment E=1.3e-12 PF13417: GST_N_3" amino acids 6 to 77 (72 residues), 74.3 bits, see alignment E=2.8e-24 PF13409: GST_N_2" amino acids 12 to 72 (61 residues), 65.9 bits, see alignment E=1.4e-21 PF14497: GST_C_3" amino acids 118 to 188 (71 residues), 26.9 bits, see alignment E=1.7e-09 PF00043: GST_C" amino acids 119 to 188 (70 residues), 34.2 bits, see alignment E=8.9e-12 PF13410: GST_C_2" amino acids 129 to 183 (55 residues), 46.4 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3514)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KDI3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PFLU_RS17145 glutathione S-transferase (Pseudomonas fluorescens SBW25-INTG)
MSEVLLYSFRRCPYAMRARLALRYSGVPVRIVEVSLKAKPAEMLALSPKGTVPVLSVDGE
VIDESLAIMQWALAQHDPDNWLLGGDPAVLALVAENDQGFKYHLDRYKYAERYPEQPMEH
YRAEGEVFLQKLEGLLTGRAYLLADHPSLADMALAPFVRQFAHVDRDWFAAAPYPRLQQW
LERFLQSPLFVGVMAKT