Protein Info for PFLU_RS17125 in Pseudomonas fluorescens SBW25-INTG

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 311 to 337 (27 residues), see Phobius details PF13519: VWA_2" amino acids 96 to 199 (104 residues), 31.5 bits, see alignment E=3.6e-11 PF00515: TPR_1" amino acids 405 to 437 (33 residues), 34.8 bits, see alignment (E = 1.5e-12) PF07719: TPR_2" amino acids 405 to 437 (33 residues), 29.8 bits, see alignment (E = 6.1e-11)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to pfs:PFLU3510)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KD86 at UniProt or InterPro

Protein Sequence (579 amino acids)

>PFLU_RS17125 VWA domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MIDLWPHWFRPWWLLLLPLLGWLLWQLWHRQKRAGRWQVILPPAFHAVLLSGGNGRESKS
PWVVLGIAWLLAVLALLGPSWQRVEQSSQKPSDPLVVLLELTPEMLATDSPPNRLEQARR
KLYDLLQARTDAQTAIVVYAGSAHTLVPLSDDLGTSRNLLEALRPSIMPEPGHRADLAVE
KALGLLKQGGLGQGRLLLIGSSLSKQERQGIRLLLQSGQAPALSILGIGSREGTPVTQEN
GEFLKDEQGAILVPRLDSPTLKAFASEMSGRYRAARLDDKDLRQLGVLDPPQALRNDGQL
LHLDTWADQGYWLLLPLLLLAACAGRRGWLFCLPLLLLSAPQPSYAFGLQDLWLRPDQQG
QYLLKKKRPAEAAEHFEDPQWQGVALYEAGNYAEAIKRFAEGNDAYSHYNRGNALAKSGE
LEAAIDAYEQALEAQPDLQPALKNKALVETLMQEQAQPEPSKPAENEDDETTQPGQTAQP
GASGQSTTGGEQSSQGQGEAGTGDTQTGNTPQTAGNEVPGSELGDEHTTTPPLRPTDASL
DGEHRQALEQWLQQIPDNPGELLRRKFWYEQQQHQDKTR