Protein Info for PFLU_RS16920 in Pseudomonas fluorescens SBW25-INTG

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details PF06808: DctM" amino acids 7 to 414 (408 residues), 425 bits, see alignment E=1.5e-131 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 487.1 bits, see alignment E=1.9e-150

Best Hits

Swiss-Prot: 84% identical to DCTM_PSEAE: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to pfs:PFLU3468)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCH5 at UniProt or InterPro

Protein Sequence (426 amino acids)

>PFLU_RS16920 TRAP transporter large permease (Pseudomonas fluorescens SBW25-INTG)
MAVLCLFLLLFVFMFLGVPIAISLGLSGAVSILMFSQDSVSSLAIKLFETSDAYTFLAIP
FFLLSGAFMTTGGVAQRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGS
IAVAGMVRSGYPKEFGAGIICNAGTLGILIPPSIVMVVYSAATETSVGKLFMAGVIPGLL
LGLMLMIAIYIVARIKKLPAQPRATFREWLTCARRAFWGLLLLVIILGGIYSGMFTPTEA
AAVAAVYSAFVALFVYKDMKLRDCPKVLLESGRLAIMLMFIIANAMLFAHVLTTEQIPQE
ITAWVLSEGLTPIGFLIMVNVVLLIAGSFMEPSAIVLILAPIFFPIAMKLGIDPIHLGIV
MVVNMEIGLVHPPVGLNLFVTSAVTGLTLGQTIRAALPWLMILLVFLIMVTYLPFISLAL
PHWLGM