Protein Info for PFLU_RS16810 in Pseudomonas fluorescens SBW25-INTG

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 857 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details PF05228: CHASE4" amino acids 70 to 226 (157 residues), 74.2 bits, see alignment E=2.4e-24 TIGR00229: PAS domain S-box protein" amino acids 310 to 426 (117 residues), 38.3 bits, see alignment E=1.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 428 to 590 (163 residues), 147.9 bits, see alignment E=2.3e-47 PF00990: GGDEF" amino acids 432 to 587 (156 residues), 162.3 bits, see alignment E=1.7e-51 PF00563: EAL" amino acids 608 to 839 (232 residues), 241.5 bits, see alignment E=1.6e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3444)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCF3 at UniProt or InterPro

Protein Sequence (857 amino acids)

>PFLU_RS16810 EAL domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MPNSLAPIVRSLSDRTSLSLARTSLFRFMGLLAVVFAAAAYSLVYLAHELDRSEQVESAF
YTRKAVQSLEKTLRVTVKDYAFWSDAYKHLHVKVDNDWAYMRGNLGATLFDDFGFQGLFV
VNDANRTVYAVVDGKLLDIDLTQWLGQPIAGILDQARAGADSETPVTAFINVHGSPALVA
AAAITPGTDPTVRADGRPASVLIFIDILNSAKLAVIGDEFGVNKLHIASPDEIGKMLLFP
LGDNGTAGSLHWEPARPGLRLMGVGLPLLGLAALLVCLMTWAISRRTTAAALALDASHSS
LQNSQNALATSEARFRDVVEASSDWVWEIDAGWRFTYLSERFEGVTGLTRYAWIGATMND
LLETESGLLSQWLSAPGRRPDISVQCRYVDAAGQERTTRLSAREMPCGGFRGTATDVTEE
VEARRRIEFLSQHDALTGLPNRTRLQAFLDGKLKALPSTEQPLVMLSLDLDRFKPVNDLL
GHAAGDRVLNEVSARLADCVRHGDLVARVGGDEFVLILTDAGTQDEVETLCKRLIESIER
TIRIDEQEVFISASIGIAIAPNDAREAAELLRYADIALYEAKAAGRNTWRFYSGDMNARI
IERRRLESDLRYAIKHAELRLHFQPRYRIADGQMVGAEALVRWQHPVRGLIAPDTFIPIA
EESGLILALSDWVLETACVCAAQWPEPLFVSVNLSPTEFKRGNLVERTQQALKSSGIDPA
RVELEITESVMLEDATGALEVMRTLKQLGVRIAMDDFGTGYSSLSYLRDFPFDGLKIDRS
FLTRLEESDDDKAIIQAIVGLGRTLALTVTAEGIETAEHLALLKAVACEEGQGYFLSRPL
DIEALNSLLDVHAGTVQ