Protein Info for PFLU_RS16665 in Pseudomonas fluorescens SBW25-INTG

Annotation: cysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 39% identical to Y2328_HALVD: Uncharacterized isochorismatase family protein HVO_2328 (HVO_2328) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 100% identity to pfs:PFLU3415)

Predicted SEED Role

"Amidases related to nicotinamidase" in subsystem NAD and NADP cofactor biosynthesis global

MetaCyc Pathways

superpathway of chorismate metabolism (42/59 steps found)
2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
enterobactin biosynthesis (4/11 steps found)
vibriobactin biosynthesis (1/9 steps found)
bacillibactin biosynthesis (3/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KD66 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PFLU_RS16665 cysteine hydrolase (Pseudomonas fluorescens SBW25-INTG)
MPPIATHTALLIIDMQQGMTQPTLGRRNNPGAEVQIQRLLDAWRQSGRPVVHIRHISRSP
GSVFWPGQPGCEFQPALEPLAHEHVVEKNVPDAFAATGLERWLQVRSIRQLVIVGVITNN
SVESTARSGGNLGFEVTVVSDACYTFDQTDLSGRLWPAEDVHALSLSNLAMDYAEVVTAD
EILAHD