Protein Info for PFLU_RS16500 in Pseudomonas fluorescens SBW25-INTG

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details PF00892: EamA" amino acids 18 to 151 (134 residues), 41.3 bits, see alignment E=8.8e-15 amino acids 169 to 305 (137 residues), 39.4 bits, see alignment E=3.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3382)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KD34 at UniProt or InterPro

Protein Sequence (311 amino acids)

>PFLU_RS16500 DMT family transporter (Pseudomonas fluorescens SBW25-INTG)
MTAAATTQTTPAPFSRPIAVLILLCMGCAFAGNHIAARVAFDDGAGVLLAILMRSGGTLL
VLAVLVLWQRQNLRLPAGAWRWQVLLGLLIATQSLCLYSAVARVPVALALLVGNVFPILL
ALLTWAFGGPRPTARTALLMGLILVGLVFVLDVPGRLSSSAEIGPQWLLGVSLAFCAAFV
FACALWITDHKLSQVRGSVRSLLTIFIVFSSVNLAGLSGALPGGLNPPASSTGWLALATL
VVLYGTGFIVLFMSVPRLDMPRNAPVMNIEPLATLLMGWIVLDQMLNAGQMLGGVIVVTG
IVLLTYRKSAR