Protein Info for PFLU_RS16410 in Pseudomonas fluorescens SBW25-INTG

Annotation: glycogen synthase GlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 41 to 507 (467 residues), 478.6 bits, see alignment E=1e-147 PF08323: Glyco_transf_5" amino acids 41 to 275 (235 residues), 245.8 bits, see alignment E=1.3e-76 PF13439: Glyco_transf_4" amino acids 129 to 262 (134 residues), 29.4 bits, see alignment E=2e-10 PF00534: Glycos_transf_1" amino acids 328 to 470 (143 residues), 58 bits, see alignment E=2.3e-19 PF13692: Glyco_trans_1_4" amino acids 333 to 469 (137 residues), 41.5 bits, see alignment E=4.3e-14

Best Hits

Swiss-Prot: 90% identical to GLGA_PSEPF: Glycogen synthase (glgA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to pfs:PFLU3364)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KD17 at UniProt or InterPro

Protein Sequence (517 amino acids)

>PFLU_RS16410 glycogen synthase GlgA (Pseudomonas fluorescens SBW25-INTG)
MISAAASIQGERVSQPVGGSTSLVDLNTVRPVPSHNPNRKKVLFVTSEFADLVKTGGLGD
VSAALPRAMAHLHDVRVLIPGYPQVMESDNPIHIIGELGGHAALPPCKIGRMDLKDGLVI
YVLICPELYEREGTPYGANNGRDWPDNHIRFARLGLAAADMAANLAQIHWCPDLVHAHDW
PAGLAPAYMHWRGSRTPTLFTIHNLAYQGVVSLASTPELGIPPHALQQEGMEFYGKMSFL
KAGMAYSSHITTVSATYAQEITTPEFGCGLDGFLASKTQQGLLSGIPNGIEDSWETSTDP
HLTHNFNIGDWEGKAVNAAQVRNLFGLHDSTGPLFAVVSRLVFQKGLDLTEAVASFIVEQ
GGQIAIIGRGEPEEENAMRELALRFPGQIGVRIGFNETDARRMFAGSDFLLMPSRYEPCG
LSQMYAQRFGSLPVARNTGGLADTIENGVTGFLFNESTVDSYKEALSRAFKVFAFPGLLN
AMRCRAMTQPFNWSQAVEPYAELYEQLVAKALGKSAK