Protein Info for PFLU_RS16075 in Pseudomonas fluorescens SBW25-INTG

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 17 to 471 (455 residues), 481.6 bits, E=1.1e-148

Best Hits

Swiss-Prot: 93% identical to VDH_PSEFL: Vanillin dehydrogenase (vdh) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3299)

MetaCyc: 84% identical to vanillin dehydrogenase (Pseudomonas sp. HR199)
Vanillin dehydrogenase. [EC: 1.2.1.67]

Predicted SEED Role

"Vanillin dehydrogenase (Hydroxybenzaldehyde dehydrogenase) (EC 1.2.1.28)" in subsystem Phenylpropanoid compound degradation (EC 1.2.1.28)

MetaCyc Pathways

• vanillin and vanillate degradation II (2/2 steps found)
• vanillin and vanillate degradation I (1/2 steps found)
• 4-coumarate degradation (aerobic) (3/5 steps found)
• 1,3-dimethylbenzene degradation to 3-methylbenzoate (1/3 steps found)
• 1,4-dimethylbenzene degradation to 4-methylbenzoate (1/3 steps found)
• 3-chlorotoluene degradation II (1/3 steps found)
• D-phenylglycine degradation (1/3 steps found)
• toluene degradation to benzoate (1/3 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• benzoate biosynthesis II (CoA-independent, non-β-oxidative) (1/4 steps found)
• 4-coumarate degradation (anaerobic) (2/6 steps found)
• mandelate degradation I (1/5 steps found)
• superpathway of vanillin and vanillate degradation (4/10 steps found)
• salicin biosynthesis (1/6 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• pinoresinol degradation (1/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation
• Biosynthesis of phenylpropanoids
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.28

Use Curated BLAST to search for 1.2.1.28 or 1.2.1.67

Sequence Analysis Tools

See C3KC99 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PFLU_RS16075 aldehyde dehydrogenase (Pseudomonas fluorescens SBW25-INTG)
MLDVPLLIGGQSCAARDGRTFERRNPVTGEVVSRVAAATLEDADAAVAAAQAAFPTWAAL
APNERRTRLLKAAEQLQARSAEFIAAAGETGAMANWYGFNVRLAANMLREAASMTTQITG
DVIPSDVPGSFAMALRQPCGVVLGIAPWNAPVILATRAIAMPLACGNTVVLKASELSPAV
HRLIGQVLQDAGLGDGVVNVISNAPEDAAAIVERLIANPAVRRVNFTGSTHVGRIVGELS
ARHLKPALLELGGKAPLLVLDDADLDAAVAAAAFGAYFNQGQICMSTERLIVDAKVADAF
TAKLAAKVATLRAGNPEAADSVLGSLVDARAGTRIKALIDDALAKGARLVVGGQLEGSIL
QPTLIDGVTEHMRLYREESFGPVAVLLRGDGDEALLRLANDSEFGLSAAIFSRDTGRALA
LAQRVESGICHINGPTVHDEAQMPFGGVKSSGYGSFGGKASIEHFTQLRWVTLQNGPRHY
PI