Protein Info for PFLU_RS15955 in Pseudomonas fluorescens SBW25-INTG

Annotation: 4-hydroxy-2-oxoheptanedioate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR02311: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase" amino acids 6 to 254 (249 residues), 432.9 bits, see alignment E=1.7e-134 PF03328: HpcH_HpaI" amino acids 18 to 243 (226 residues), 198.5 bits, see alignment E=4.8e-63

Best Hits

Swiss-Prot: 66% identical to HPCH_KLEP3: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 100% identity to pfs:PFLU3276)

MetaCyc: 65% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC76 at UniProt or InterPro

Protein Sequence (267 amino acids)

>PFLU_RS15955 4-hydroxy-2-oxoheptanedioate aldolase (Pseudomonas fluorescens SBW25-INTG)
MDMPVNTFKQRLRSGETQIGLWLGLSDAYCAELAANAGFDWLLIDGEHAPNDLRGMLGQL
QAVAPYPSHPVIRPVVGDTALIKQVLDIGVQTLLVPMVENAEQARQLVNAIHYPPNGVRG
VGSALARASRWNSIPGYLDHADEQICLLVQIESREGLANLDAIAAVEGVDGVFIGPADLS
ASMGHRGNPAHPQVQTAIEDAIARIRSAGKAAGILSADPTLARRYIELGAAFVAVGVDTT
VLMRGLQTLAAAFKGSSAPTSSAGAIY