Protein Info for PFLU_RS15895 in Pseudomonas fluorescens SBW25-INTG

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 241 to 241 (1 residues), see Phobius details amino acids 243 to 272 (30 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 214 (192 residues), 93 bits, see alignment E=1.8e-30 amino acids 224 to 391 (168 residues), 35.3 bits, see alignment E=6.5e-13 PF00083: Sugar_tr" amino acids 70 to 190 (121 residues), 25 bits, see alignment E=8.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3263)

Predicted SEED Role

"General substrate transporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCZ1 at UniProt or InterPro

Protein Sequence (410 amino acids)

>PFLU_RS15895 MFS transporter (Pseudomonas fluorescens SBW25-INTG)
MNSSHSDSLSPRQATGRREGLVLMLGSSLTIMGAVMVAPILPKLGAEFGPLEPRADLLVP
LAVTGPALAIALCAPLAGWLADRVGRKALLVIATLLYAVLGAIPALLDNLPAIVGVRLLF
GAAEAAVMTCCATLIADYWHGEERLRYINRQVVTIGLVGSLFFVVGGALGEHSWRLPFLL
YLLPLLLVPVMIKVLWEPAATRRLVETPEQGRVAMLPLVVGYLLILSGMVLSFVVPIQAP
ILLVSLGVTSSTMIGLSAGLALLATLVGSLAWPLLRRRVGIAGCNALLLSLLGLGLWLLM
RGQSYNAVLVAVLIHGVGAGLLVPNAMAPVMNALNAKNRGRGLGGFTAFLYFGQFVSPLV
VAVLSVYSGDLRHAIQWLAFASFASALAWALAGLQARRKALTQILGSSHS