Protein Info for PFLU_RS15720 in Pseudomonas fluorescens SBW25-INTG

Annotation: cyclic peptide export ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 8 to 531 (524 residues), 441.9 bits, see alignment E=1.7e-136 PF00664: ABC_membrane" amino acids 51 to 169 (119 residues), 30.3 bits, see alignment E=3.5e-11 PF00005: ABC_tran" amino acids 346 to 479 (134 residues), 77.2 bits, see alignment E=2.1e-25

Best Hits

KEGG orthology group: K06160, putative ATP-binding cassette transporter (inferred from 100% identity to pfs:PFLU3226)

Predicted SEED Role

"ATP-binding protein syrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC56 at UniProt or InterPro

Protein Sequence (543 amino acids)

>PFLU_RS15720 cyclic peptide export ABC transporter (Pseudomonas fluorescens SBW25-INTG)
MDLLILMAKRSWRALLVATLTGLACGLAAAGLIAMINHSLTVFDQLRPIDGLYFGGLVLL
VAVSRIISDISLLRLGQAAVNDMRLHLSAKLIDTPYAQLQRLGKHRLLAMLTDDTQTISQ
AVELVPILLVNGGIIIACLGYLGWLSLPLLGLTVLLIVLGSLSFNWPQRRALTSISRARE
LKDQLFEHYRLLTDGSKELQLNHPRRQHFFTRLLLPVSQQYRRDFVRGMSIYAVVLNWGN
AVFYLLIGMVLFAAPHFIELSVSLVTGYILAILYMITPLSELMHALPTLGRASVALNKIR
ALEGEMQGASETLETFAPTRVRSLVCRDVTHTYYREREDGHFTLGPINVTLKASETVFIT
GGNGSGKTTLALLLTGLYRPESGDVMLDEQVSSSQDNHHFRQHFSAIFTDFCLFENLFDG
DDPQLVQQAQDYLVHLQLDHKVQIDQGRLTTLALSTGQRKRLALLSAYLDDRPCYLFDEW
AADQDPVFKHFFYTRILSDLRARGKLVIVISHDDAYFGLADRLLRIEHGRLSEAPLTAGA
AQS